PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0957s0060.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family SRS
Protein Properties Length: 314aa    MW: 34038.4 Da    PI: 8.1544
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0957s0060.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702222.58.4e-69942444153
                  DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.aeaaskrkrelkskkqsalsst 89 
                             g+++CqdCGnq+kkdC h+RCRtCCksrgf C+thvkstWv+aakrrerqqql+a+++++++++ ++   +++++l++++  a+s +
  SapurV1A.0957s0060.1.p  94 GGMNCQDCGNQSKKDCPHMRCRTCCKSRGFPCQTHVKSTWVSAAKRRERQQQLTALQQHNQQEQqQQFLGENPKRLRENHGGASSLA 180
                             789***************************************************999988877733334455555555555555555 PP

                  DUF702  90 klssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                              +  a s++ le + +P+e++sea+frcv+vs++dd++++laYqtav+igGhvf+GiLydqG++
  SapurV1A.0957s0060.1.p 181 CTRLAASTSGLELTAFPPELNSEAIFRCVKVSAMDDADDQLAYQTAVNIGGHVFRGILYDQGPD 244
                             555566667899999***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.2E-6595244IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.5E-2597139IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016244.5E-25195243IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MAGWFYLGGG EGPSRKQDQE KEDNNSSFVL HRPSNEEIYN NKGFELWPQY YHQQQNMNSF  60
SFGVGPSRRS SSDDHSSRSG FSLTRQGGGG GLRGGMNCQD CGNQSKKDCP HMRCRTCCKS  120
RGFPCQTHVK STWVSAAKRR ERQQQLTALQ QHNQQEQQQQ FLGENPKRLR ENHGGASSLA  180
CTRLAASTSG LELTAFPPEL NSEAIFRCVK VSAMDDADDQ LAYQTAVNIG GHVFRGILYD  240
QGPDGRYTST GGESSSSGAQ QLLMAAAATS TTGTTTNTSN PSAGNTLLDP SSLYPAPLNA  300
FIAGTQFFAP PRS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011045159.11e-177PREDICTED: protein SHI RELATED SEQUENCE 5-like
SwissprotQ9LQZ52e-94SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLB9H4I21e-160B9H4I2_POPTR; Uncharacterized protein
STRINGPOPTR_0005s25560.11e-160(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.18e-79SHI-related sequence 5